SCOPe 2.07: Domain d2pr4h1: 2pr4 H:1-132

Lineage for d2pr4h1 (2pr4 H:1-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (71 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d2pr4h1: 2pr4 H:1-132 [139748]
   Other proteins in same PDB: d2pr4h2, d2pr4l1, d2pr4l2
   automatically matched to d2f5ah1

Details for d2pr4h1

PDB Entry: 2pr4, 2.05 Å

PDB Description: Crystal Structure of Fab' from the HIV-1 Neutralizing Antibody 2F5

PDB Compounds: (H:) nmAb 2F5 Fab' light Chain

SCOPe Domain Sequences for d2pr4h1:

Sequence, based on SEQRES records:

>d2pr4h1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Sequence, based on observed residues (ATOM records):

>d2pr4h1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpgpvnamdvwgqgitvti
ss

Timeline for d2pr4h1:

• d2pr4h1 first appeared in SCOP 1.73
  
• d2pr4h1 appears in SCOPe 2.06
  
• d2pr4h1 appears in the current release, SCOPe 2.08