Lineage for d2pr4h1 (2pr4 H:1-132)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781741Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831
    SQ NA # humanized antibody
    SQ NA # Humanized antibody
    SQ NA # engineered antibody
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 781763Domain d2pr4h1: 2pr4 H:1-132 [139748]
    Other proteins in same PDB: d2pr4h2
    automatically matched to d2f5ah1

Details for d2pr4h1

PDB Entry: 2pr4 (more details), 2.05 Å

PDB Description: Crystal Structure of Fab' from the HIV-1 Neutralizing Antibody 2F5
PDB Compounds: (H:) nmAb 2F5 Fab' light Chain

SCOP Domain Sequences for d2pr4h1:

Sequence, based on SEQRES records: (download)

>d2pr4h1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Sequence, based on observed residues (ATOM records): (download)

>d2pr4h1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpgpvnamdvwgqgitvti
ss

SCOP Domain Coordinates for d2pr4h1:

Click to download the PDB-style file with coordinates for d2pr4h1.
(The format of our PDB-style files is described here.)

Timeline for d2pr4h1: