Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries) Uniprot P19866 |
Domain d2pkrh2: 2pkr H:149-312 [139725] Other proteins in same PDB: d2pkra1, d2pkrb1, d2pkrc1, d2pkrd1, d2pkrh1, d2pkri1, d2pkrl1, d2pkrm1, d2pkro1, d2pkrp1, d2pkrq1, d2pkrr1 automatically matched to d1nboa2 complexed with ndp, so4 |
PDB Entry: 2pkr (more details), 2.4 Å
SCOP Domain Sequences for d2pkrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkrh2 d.81.1.1 (H:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd
Timeline for d2pkrh2: