SCOP 1.73: Domain d2pkqs1: 2pkq S:0-148,S:313-332

Lineage for d2pkqs1 (2pkq S:0-148,S:313-332)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)

8. Domain d2pkqs1: 2pkq S:0-148,S:313-332 [139714]
   Other proteins in same PDB: d2pkqp2, d2pkqr2, d2pkqs2
   automatically matched to d1nboa1
   complexed with ndp, so4

Details for d2pkqs1

PDB Entry: 2pkq, 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp

PDB Compounds: (S:) glyceraldehyde-3-phosphate dehydrogenase a

SCOP Domain Sequences for d2pkqs1:

Sequence; same for both SEQRES and ATOM records:

>d2pkqs1 c.2.1.3 (S:0-148,S:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankw

Timeline for d2pkqs1:

• d2pkqs1 is new in SCOP 1.73
  
• d2pkqs1 appears in SCOP 1.75
  
• d2pkqs1 appears in the current release, SCOPe 2.08