SCOP 1.73: Domain d2pfqa1: 2pfq A:252-327

Lineage for d2pfqa1 (2pfq A:252-327)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (15 PDB entries)

8. Domain d2pfqa1: 2pfq A:252-327 [139681]
   Other proteins in same PDB: d2pfqa2, d2pfqa3
   automatically matched to d1nzpa_
   complexed with dcp, mg, mn, na, ppv; mutant

Details for d2pfqa1

PDB Entry: 2pfq, 2.1 Å

PDB Description: manganese promotes catalysis in a dna polymerase lambda-dna crystal

PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d2pfqa1:

Sequence; same for both SEQRES and ATOM records:

>d2pfqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldh

Timeline for d2pfqa1:

• d2pfqa1 is new in SCOP 1.73
  
• d2pfqa1 appears in SCOP 1.75
  
• d2pfqa1 appears in the current release, SCOPe 2.08