Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (15 PDB entries) |
Domain d2pfqa1: 2pfq A:252-327 [139681] Other proteins in same PDB: d2pfqa2, d2pfqa3 automatically matched to d1nzpa_ complexed with dcp, mg, mn, na, ppv; mutant |
PDB Entry: 2pfq (more details), 2.1 Å
SCOP Domain Sequences for d2pfqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pfqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae kiieilesghlrkldh
Timeline for d2pfqa1: