Lineage for d2pfoa1 (2pfo A:253-328)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737967Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1737968Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1738136Protein DNA polymerase lambda [101251] (1 species)
  7. 1738137Species Human (Homo sapiens) [TaxId:9606] [101252] (27 PDB entries)
  8. 1738145Domain d2pfoa1: 2pfo A:253-328 [139675]
    Other proteins in same PDB: d2pfoa2, d2pfoa3
    automated match to d1rzta1
    protein/DNA complex; complexed with dup, edo, mg, mn, na

Details for d2pfoa1

PDB Entry: 2pfo (more details), 2 Å

PDB Description: dna polymerase lambda in complex with dna and dupnpp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2pfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfoa1 a.60.6.1 (A:253-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
iieilesghlrkldhi

SCOPe Domain Coordinates for d2pfoa1:

Click to download the PDB-style file with coordinates for d2pfoa1.
(The format of our PDB-style files is described here.)

Timeline for d2pfoa1: