Lineage for d2pe6b1 (2pe6 B:21-94)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717170Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 717176Species Human (Homo sapiens) [TaxId:9606] [54242] (13 PDB entries)
  8. 717180Domain d2pe6b1: 2pe6 B:21-94 [139668]
    Other proteins in same PDB: d2pe6a1
    automatically matched to d1tgzb_

Details for d2pe6b1

PDB Entry: 2pe6 (more details), 2.4 Å

PDB Description: non-covalent complex between human sumo-1 and human ubc9
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOP Domain Sequences for d2pe6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pe6b1 d.15.1.1 (B:21-94) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeq

SCOP Domain Coordinates for d2pe6b1:

Click to download the PDB-style file with coordinates for d2pe6b1.
(The format of our PDB-style files is described here.)

Timeline for d2pe6b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pe6a1