Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries) identical sequence in many other species |
Domain d2pe6a2: 2pe6 A:1-158 [139667] Other proteins in same PDB: d2pe6a3, d2pe6b_ automated match to d1u9b__ |
PDB Entry: 2pe6 (more details), 2.4 Å
SCOPe Domain Sequences for d2pe6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pe6a2 d.20.1.1 (A:1-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell nepniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d2pe6a2: