SCOPe 2.01: Domain d2pb8a_: 2pb8 A:

Lineage for d2pb8a_ (2pb8 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (26 PDB entries)

8. Domain d2pb8a_: 2pb8 A: [139646]
   automated match to d1tgma_
   complexed with act

Details for d2pb8a_

PDB Entry: 2pb8, 2 Å

PDB Description: crystal structure of the complex formed between phospholipase a2 and peptide ala-val-tyr-ser at 2.0 a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2pb8a_:

Sequence; same for both SEQRES and ATOM records:

>d2pb8a_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d2pb8a_:

• d2pb8a_ first appeared in SCOP 1.73, called d2pb8a1
  
• d2pb8a_ was called d2pb8a1 in SCOP 1.75
  
• d2pb8a_ appears in SCOPe 2.02
  
• d2pb8a_ appears in the current release, SCOPe 2.08