Lineage for d2paqb1 (2paq B:2-187)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780221Family a.211.1.1: HD domain [101340] (13 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 780222Protein 5'-nucleotidase YfbR [116969] (1 species)
  7. 780223Species Escherichia coli [TaxId:562] [116970] (1 PDB entry)
    Uniprot P76491
    Structural genomics target
  8. 780225Domain d2paqb1: 2paq B:2-187 [139644]
    automatically matched to d1wpha_

Details for d2paqb1

PDB Entry: 2paq (more details), 2.1 Å

PDB Description: crystal structure of the 5'-deoxynucleotidase yfbr
PDB Compounds: (B:) 5'-deoxynucleotidase YfbR

SCOP Domain Sequences for d2paqb1:

Sequence, based on SEQRES records: (download)

>d2paqb1 a.211.1.1 (B:2-187) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records): (download)

>d2paqb1 a.211.1.1 (B:2-187) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpeykaiekiaqqklvdmvpeelrdifaplidehaysdeeks
lvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

SCOP Domain Coordinates for d2paqb1:

Click to download the PDB-style file with coordinates for d2paqb1.
(The format of our PDB-style files is described here.)

Timeline for d2paqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2paqa1