SCOPe 2.05: Domain d2pafb1: 2paf B:62-330

Lineage for d2pafb1 (2paf B:62-330)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)

8. Domain d2pafb1: 2paf B:62-330 [139642]
   automatically matched to d1jyea_
   complexed with npf

Details for d2pafb1

PDB Entry: 2paf, 3.5 Å

PDB Description: crystal structure of the lactose repressor bound to anti-inducer onpf in induced state

PDB Compounds: (B:) lactose operon repressor

SCOPe Domain Sequences for d2pafb1:

Sequence; same for both SEQRES and ATOM records:

>d2pafb1 c.93.1.1 (B:62-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

Timeline for d2pafb1:

• d2pafb1 first appeared in SCOP 1.73
  
• d2pafb1 appears in SCOPe 2.04
  
• d2pafb1 appears in SCOPe 2.06
  
• d2pafb1 appears in the current release, SCOPe 2.08