Lineage for d2p9uf_ (2p9u F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050398Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1050472Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1050473Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1050496Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1050497Species Cow (Bos taurus) [TaxId:9913] [69648] (13 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1050505Domain d2p9uf_: 2p9u F: [139636]
    Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9uc_, d2p9ud1, d2p9ud2, d2p9ue_, d2p9ug_
    automated match to d1k8kf_
    complexed with anp, ca

Details for d2p9uf_

PDB Entry: 2p9u (more details), 2.75 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with amp- pnp and calcium
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d2p9uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9uf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d2p9uf_:

Click to download the PDB-style file with coordinates for d2p9uf_.
(The format of our PDB-style files is described here.)

Timeline for d2p9uf_: