Lineage for d2p9ue_ (2p9u E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926559Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 926560Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
  5. 926561Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 926567Protein automated matches [190347] (1 species)
    not a true protein
  7. 926568Species Cow (Bos taurus) [TaxId:9913] [187174] (10 PDB entries)
  8. 926573Domain d2p9ue_: 2p9u E: [139635]
    Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9uc_, d2p9ud1, d2p9ud2, d2p9uf_, d2p9ug_
    automated match to d1k8ke_
    complexed with anp, ca

Details for d2p9ue_

PDB Entry: 2p9u (more details), 2.75 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with amp- pnp and calcium
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d2p9ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ue_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOPe Domain Coordinates for d2p9ue_:

Click to download the PDB-style file with coordinates for d2p9ue_.
(The format of our PDB-style files is described here.)

Timeline for d2p9ue_: