Lineage for d2p9sa1 (2p9s A:3-160)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995229Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 995230Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
    Uniprot P61158
  8. 995243Domain d2p9sa1: 2p9s A:3-160 [139622]
    Other proteins in same PDB: d2p9sc_, d2p9sd1, d2p9sd2, d2p9se_, d2p9sf_, d2p9sg_
    automatically matched to d1tyqa1
    complexed with atp, mg

Details for d2p9sa1

PDB Entry: 2p9s (more details), 2.68 Å

PDB Description: Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+
PDB Compounds: (A:) actin-like protein 3

SCOPe Domain Sequences for d2p9sa1:

Sequence, based on SEQRES records: (download)

>d2p9sa1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d2p9sa1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrge

SCOPe Domain Coordinates for d2p9sa1:

Click to download the PDB-style file with coordinates for d2p9sa1.
(The format of our PDB-style files is described here.)

Timeline for d2p9sa1: