Lineage for d2p9pf1 (2p9p F:4-168)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879922Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 879991Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 879992Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 880015Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 880016Species Cow (Bos taurus) [TaxId:9913] [69648] (10 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 880026Domain d2p9pf1: 2p9p F:4-168 [139620]
    Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pc1, d2p9pd1, d2p9pd2, d2p9pe1, d2p9pg1
    automatically matched to d1k8kf_
    complexed with adp, ca

Details for d2p9pf1

PDB Entry: 2p9p (more details), 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOP Domain Sequences for d2p9pf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9pf1 d.198.2.1 (F:4-168) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvli
egsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfht
eqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOP Domain Coordinates for d2p9pf1:

Click to download the PDB-style file with coordinates for d2p9pf1.
(The format of our PDB-style files is described here.)

Timeline for d2p9pf1: