Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) |
Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
Domain d2p9pd2: 2p9p D:121-283 [139618] Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pc_, d2p9pe_, d2p9pf_, d2p9pg_ automatically matched to d1k8kd2 complexed with adp, ca |
PDB Entry: 2p9p (more details), 2.9 Å
SCOPe Domain Sequences for d2p9pd2:
Sequence, based on SEQRES records: (download)
>d2p9pd2 d.198.2.1 (D:121-283) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd
>d2p9pd2 d.198.2.1 (D:121-283) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshreppgdnigyitfvlfprhtnasardntinlihtfrdy lhyhikcskayihtrmraktsdflkvlnrarpd
Timeline for d2p9pd2: