Lineage for d2p9ng1 (2p9n G:9-151)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776088Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 776089Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (1 protein)
  6. 776090Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)
  7. 776091Species Cow (Bos taurus) [TaxId:9913] [69106] (10 PDB entries)
    Uniprot Q9CPW4 # 99% sequence identity
  8. 776100Domain d2p9ng1: 2p9n G:9-151 [139613]
    Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nc1, d2p9nd1, d2p9nd2, d2p9ne1, d2p9nf1
    automatically matched to d1k8kg_
    complexed with adp, ca

Details for d2p9ng1

PDB Entry: 2p9n (more details), 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOP Domain Sequences for d2p9ng1:

Sequence, based on SEQRES records: (download)

>d2p9ng1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d2p9ng1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdagpdegevdsclrqgnmtaalqaalknppintksqavkdrag
sivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdssavllqwhekalaagg
vgsivrvltarktv

SCOP Domain Coordinates for d2p9ng1:

Click to download the PDB-style file with coordinates for d2p9ng1.
(The format of our PDB-style files is described here.)

Timeline for d2p9ng1: