SCOP 1.75: Domain d2p9na1: 2p9n A:3-160

Lineage for d2p9na1 (2p9n A:3-160)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
   Uniprot P61158

8. Domain d2p9na1: 2p9n A:3-160 [139606]
   Other proteins in same PDB: d2p9nc1, d2p9nd1, d2p9nd2, d2p9ne1, d2p9nf1, d2p9ng1
   automatically matched to d1tyqa1
   complexed with adp, ca

Details for d2p9na1

PDB Entry: 2p9n, 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp

PDB Compounds: (A:) actin-like protein 3

SCOP Domain Sequences for d2p9na1:

Sequence, based on SEQRES records:

>d2p9na1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d2p9na1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat
kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf
nvpglyiavqavlalaaswtsvge

Timeline for d2p9na1:

• d2p9na1 first appeared in SCOP 1.73
  
• d2p9na1 appears in SCOPe 2.01
  
• d2p9na1 appears in the current release, SCOPe 2.08