SCOP 1.75: Domain d2p9lg1: 2p9l G:9-151

Lineage for d2p9lg1 (2p9l G:9-151)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family)

5. Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (1 protein)

6. Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69106] (10 PDB entries)
   Uniprot Q9CPW4 # 99% sequence identity

8. Domain d2p9lg1: 2p9l G:9-151 [139605]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9ld1, d2p9ld2, d2p9le1, d2p9lf1
   automatically matched to d1k8kg_

Details for d2p9lg1

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOP Domain Sequences for d2p9lg1:

Sequence, based on SEQRES records:

>d2p9lg1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records):

>d2p9lg1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr
agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
aggvgsivrvltarktv

Timeline for d2p9lg1:

• d2p9lg1 first appeared in SCOP 1.73
  
• d2p9lg1 is called d2p9lg_ in SCOPe 2.01
  
• d2p9lg1 appears in the current release, SCOPe 2.07, called d2p9lg_