Lineage for d2p9lf_ (2p9l F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445470Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1445552Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1445553Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1445588Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1445589Species Cow (Bos taurus) [TaxId:9913] [69648] (16 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1445597Domain d2p9lf_: 2p9l F: [139604]
    Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9le_, d2p9lg_
    automated match to d1k8kf_

Details for d2p9lf_

PDB Entry: 2p9l (more details), 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d2p9lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9lf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d2p9lf_:

Click to download the PDB-style file with coordinates for d2p9lf_.
(The format of our PDB-style files is described here.)

Timeline for d2p9lf_: