| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.198: Secretion chaperone-like [69634] (3 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
| Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
| Protein ARPC4 (20 kDa subunit) [69647] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [69648] (10 PDB entries) |
| Domain d2p9lf1: 2p9l F:3-168 [139604] Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9ld1, d2p9ld2, d2p9le1, d2p9lg1 automatically matched to d1k8kf_ |
PDB Entry: 2p9l (more details), 2.65 Å
SCOP Domain Sequences for d2p9lf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9lf1 d.198.2.1 (F:3-168) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
Timeline for d2p9lf1: