SCOP 1.75: Domain d2p9le1: 2p9l E:2-174

Lineage for d2p9le1 (2p9l E:2-174)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
   5 helices; one helix is surrounded by the others

4. Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family)

5. Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein)

6. Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries)
   Uniprot O15145 # 100% sequence identity

8. Domain d2p9le1: 2p9l E:2-174 [139603]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9ld1, d2p9ld2, d2p9lf1, d2p9lg1
   automatically matched to d1k8ke_

Details for d2p9le1

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOP Domain Sequences for d2p9le1:

Sequence; same for both SEQRES and ATOM records:

>d2p9le1 a.148.1.1 (E:2-174) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

Timeline for d2p9le1:

• d2p9le1 first appeared in SCOP 1.73
  
• d2p9le1 is called d2p9le_ in SCOPe 2.01
  
• d2p9le1 appears in the current release, SCOPe 2.08, called d2p9le_