Lineage for d2p9le1 (2p9l E:2-174)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650091Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 650092Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
  5. 650093Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein)
  6. 650094Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 650095Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries)
  8. 650101Domain d2p9le1: 2p9l E:2-174 [139603]
    Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9ld1, d2p9ld2, d2p9lf1, d2p9lg1
    automatically matched to d1k8ke_

Details for d2p9le1

PDB Entry: 2p9l (more details), 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOP Domain Sequences for d2p9le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9le1 a.148.1.1 (E:2-174) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOP Domain Coordinates for d2p9le1:

Click to download the PDB-style file with coordinates for d2p9le1.
(The format of our PDB-style files is described here.)

Timeline for d2p9le1: