SCOP 1.75: Domain d2p9ld2: 2p9l D:121-282

Lineage for d2p9ld2 (2p9l D:121-282)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
   Uniprot O15144 1-282 # 100% sequence identity

8. Domain d2p9ld2: 2p9l D:121-282 [139602]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9le1, d2p9lf1, d2p9lg1
   automatically matched to d1k8kd2

Details for d2p9ld2

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOP Domain Sequences for d2p9ld2:

Sequence, based on SEQRES records:

>d2p9ld2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records):

>d2p9ld2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepptdaavgdnigyitfvlfprhtnasardntinlih
tfrdylhyhikcskayihtrmraktsdflkvlnrarp

Timeline for d2p9ld2:

• d2p9ld2 first appeared in SCOP 1.73
  
• d2p9ld2 appears in SCOPe 2.01
  
• d2p9ld2 appears in the current release, SCOPe 2.08