Lineage for d2p9lc1 (2p9l C:2-372)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807549Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 807635Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 807636Family b.69.4.1: WD40-repeat [50979] (10 proteins)
  6. 807654Protein Arp2/3 complex 41 kDa subunit ARPC1 [69313] (1 species)
  7. 807655Species Cow (Bos taurus) [TaxId:9913] [69314] (10 PDB entries)
    Uniprot Q58CQ2
  8. 807661Domain d2p9lc1: 2p9l C:2-372 [139600]
    Other proteins in same PDB: d2p9la1, d2p9la2, d2p9ld1, d2p9ld2, d2p9le1, d2p9lf1, d2p9lg1
    automatically matched to d1tyqc_

Details for d2p9lc1

PDB Entry: 2p9l (more details), 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex
PDB Compounds: (C:) Actin-related protein 2/3 complex subunit 1B

SCOP Domain Sequences for d2p9lc1:

Sequence, based on SEQRES records: (download)

>d2p9lc1 b.69.4.1 (C:2-372) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltarer
fqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrs
lesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d2p9lc1 b.69.4.1 (C:2-372) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsq
isvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOP Domain Coordinates for d2p9lc1:

Click to download the PDB-style file with coordinates for d2p9lc1.
(The format of our PDB-style files is described here.)

Timeline for d2p9lc1: