| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
| Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries) Uniprot P61158 |
| Domain d2p9la1: 2p9l A:3-160 [139598] Other proteins in same PDB: d2p9lc1, d2p9ld1, d2p9ld2, d2p9le1, d2p9lf1, d2p9lg1 automatically matched to d1tyqa1 |
PDB Entry: 2p9l (more details), 2.65 Å
SCOP Domain Sequences for d2p9la1:
Sequence, based on SEQRES records: (download)
>d2p9la1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d2p9la1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsqvge
Timeline for d2p9la1: