![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
![]() | Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
![]() | Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
![]() | Domain d2p9kd1: 2p9k D:1-120 [139593] Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9ke_, d2p9kf_, d2p9kg_ automatically matched to d1k8kd1 complexed with atp, ca |
PDB Entry: 2p9k (more details), 2.59 Å
SCOPe Domain Sequences for d2p9kd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9kd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
Timeline for d2p9kd1: