Lineage for d2p9ka2 (2p9k A:161-412)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 836098Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 836099Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
    Uniprot P61158
  8. 836107Domain d2p9ka2: 2p9k A:161-412 [139591]
    Other proteins in same PDB: d2p9kc1, d2p9kd1, d2p9kd2, d2p9ke1, d2p9kf1, d2p9kg1
    automatically matched to d1k8ka2
    complexed with atp, ca

Details for d2p9ka2

PDB Entry: 2p9k (more details), 2.59 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
PDB Compounds: (A:) actin-like protein 3

SCOP Domain Sequences for d2p9ka2:

Sequence, based on SEQRES records: (download)

>d2p9ka2 c.55.1.1 (A:161-412) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnp

Sequence, based on observed residues (ATOM records): (download)

>d2p9ka2 c.55.1.1 (A:161-412) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelskpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig
psicrhnp

SCOP Domain Coordinates for d2p9ka2:

Click to download the PDB-style file with coordinates for d2p9ka2.
(The format of our PDB-style files is described here.)

Timeline for d2p9ka2: