![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) ![]() |
![]() | Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins) |
![]() | Protein automated matches [190348] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187175] (10 PDB entries) |
![]() | Domain d2p9ig_: 2p9i G: [139589] Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic_, d2p9id1, d2p9id2, d2p9ie_, d2p9if_ automated match to d1k8kg_ complexed with adp, ca |
PDB Entry: 2p9i (more details), 2.46 Å
SCOPe Domain Sequences for d2p9ig_:
Sequence, based on SEQRES records: (download)
>d2p9ig_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw hekalaaggvgsivrvltarktv
>d2p9ig_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala aggvgsivrvltarktv
Timeline for d2p9ig_: