| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) ![]() |
| Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (1 protein) |
| Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [69106] (10 PDB entries) Uniprot Q9CPW4 # 99% sequence identity |
| Domain d2p9ig1: 2p9i G:9-151 [139589] Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic1, d2p9id1, d2p9id2, d2p9ie1, d2p9if1 automatically matched to d1k8kg_ complexed with adp, ca |
PDB Entry: 2p9i (more details), 2.46 Å
SCOP Domain Sequences for d2p9ig1:
Sequence, based on SEQRES records: (download)
>d2p9ig1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv
>d2p9ig1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr
agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
aggvgsivrvltarktv
Timeline for d2p9ig1: