Lineage for d2p9id2 (2p9i D:121-283)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228690Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1228764Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1228765Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1228766Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1228767Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1228771Domain d2p9id2: 2p9i D:121-283 [139586]
    Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic_, d2p9ie_, d2p9if_, d2p9ig_
    automatically matched to d1k8kd2
    complexed with adp, ca

Details for d2p9id2

PDB Entry: 2p9i (more details), 2.46 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d2p9id2:

Sequence, based on SEQRES records: (download)

>d2p9id2 d.198.2.1 (D:121-283) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd

Sequence, based on observed residues (ATOM records): (download)

>d2p9id2 d.198.2.1 (D:121-283) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshreppleldaavgdnigyitfvlfprhtnasardntinl
ihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd

SCOPe Domain Coordinates for d2p9id2:

Click to download the PDB-style file with coordinates for d2p9id2.
(The format of our PDB-style files is described here.)

Timeline for d2p9id2: