SCOP 1.73: Domain d2p9hb1: 2p9h B:62-330

Lineage for d2p9hb1 (2p9h B:62-330)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (10 PDB entries)

8. Domain d2p9hb1: 2p9h B:62-330 [139581]
   automatically matched to d1jyea_
   complexed with ipt

Details for d2p9hb1

PDB Entry: 2p9h, 2 Å

PDB Description: high resolution structure of the lactose repressor bound to iptg

PDB Compounds: (B:) lactose operon repressor

SCOP Domain Sequences for d2p9hb1:

Sequence; same for both SEQRES and ATOM records:

>d2p9hb1 c.93.1.1 (B:62-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

Timeline for d2p9hb1:

• d2p9hb1 is new in SCOP 1.73
  
• d2p9hb1 appears in SCOP 1.75
  
• d2p9hb1 appears in the current release, SCOPe 2.08, called d2p9hb_