Lineage for d2p8zt5 (2p8z T:730-842)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416679Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 1416680Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1416681Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 1416682Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (16 PDB entries)
    Uniprot P32324
  8. 1416740Domain d2p8zt5: 2p8z T:730-842 [139555]
    Other proteins in same PDB: d2p8zt1, d2p8zt2, d2p8zt3
    automatically matched to d1n0ua5
    complexed with apr, gnp, so1

Details for d2p8zt5

PDB Entry: 2p8z (more details), 8.9 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8zt5:

Sequence, based on SEQRES records: (download)

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa
fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d2p8zt5:

Click to download the PDB-style file with coordinates for d2p8zt5.
(The format of our PDB-style files is described here.)

Timeline for d2p8zt5: