SCOPe 2.04: Domain d2p8yt4: 2p8y T:482-560

Lineage for d2p8yt4 (2p8y T:482-560)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor 2 (eEF-2) [82677] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
   Uniprot P32324

8. Domain d2p8yt4: 2p8y T:482-560 [139549]
   Other proteins in same PDB: d2p8yt1, d2p8yt2, d2p8yt3
   automatically matched to d1n0ua4
   complexed with apr, gdp, so1

Details for d2p8yt4

PDB Entry: 2p8y, 11.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdp:sordarin cryo- em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8yt4:

Sequence; same for both SEQRES and ATOM records:

>d2p8yt4 d.58.11.1 (T:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

Timeline for d2p8yt4:

• d2p8yt4 first appeared in SCOP 1.73
  
• d2p8yt4 appears in SCOPe 2.03
  
• d2p8yt4 appears in SCOPe 2.05
  
• d2p8yt4 appears in the current release, SCOPe 2.08