Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
Domain d2p8xt5: 2p8x T:730-842 [139545] Other proteins in same PDB: d2p8xt1, d2p8xt2, d2p8xt3 automatically matched to d1n0ua5 complexed with apr, gnp |
PDB Entry: 2p8x (more details), 9.7 Å
SCOPe Domain Sequences for d2p8xt5:
Sequence, based on SEQRES records: (download)
>d2p8xt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
>d2p8xt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2p8xt5:
View in 3D Domains from same chain: (mouse over for more information) d2p8xt1, d2p8xt2, d2p8xt3, d2p8xt4 |