SCOP 1.73: Domain d2p8mb2: 2p8m B:114-213

Lineage for d2p8mb2 (2p8m B:114-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2p8mb2: 2p8m B:114-213 [139529]
   Other proteins in same PDB: d2p8mb1
   automatically matched to d2f5ah2

Details for d2p8mb2

PDB Entry: 2p8m, 2.7 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide elleldkwaslwn in new crystal form

PDB Compounds: (B:) nmAb 2F5, heavy chain

SCOP Domain Sequences for d2p8mb2:

Sequence, based on SEQRES records:

>d2p8mb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records):

>d2p8mb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtytcnvnhkpsntkvdkrvep

Timeline for d2p8mb2:

• d2p8mb2 is new in SCOP 1.73
  
• d2p8mb2 appears in SCOP 1.75
  
• d2p8mb2 appears in the current release, SCOPe 2.08