Lineage for d2p3rg1 (2p3r G:2-253)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836354Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 836355Protein Glycerol kinase [53090] (2 species)
  7. 836365Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 836378Domain d2p3rg1: 2p3r G:2-253 [139483]
    automatically matched to d1bu6y1
    complexed with gol; mutant

Details for d2p3rg1

PDB Entry: 2p3r (more details), 2 Å

PDB Description: Crystal structure of a hyperactive Escherichia coli glycerol kinase mutant Gly230->Asp obtained using microfluidic crystallization devices
PDB Compounds: (G:) glycerol kinase

SCOP Domain Sequences for d2p3rg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3rg1 c.55.1.4 (G:2-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnidgkggtripisg
iagdqqaalfgq

SCOP Domain Coordinates for d2p3rg1:

Click to download the PDB-style file with coordinates for d2p3rg1.
(The format of our PDB-style files is described here.)

Timeline for d2p3rg1: