SCOP 1.75: Domain d2p3rf1: 2p3r F:2-253

Lineage for d2p3rf1 (2p3r F:2-253)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)

8. Domain d2p3rf1: 2p3r F:2-253 [139481]
   automatically matched to d1bu6y1
   complexed with gol; mutant

Details for d2p3rf1

PDB Entry: 2p3r, 2 Å

PDB Description: Crystal structure of a hyperactive Escherichia coli glycerol kinase mutant Gly230->Asp obtained using microfluidic crystallization devices

PDB Compounds: (F:) glycerol kinase

SCOP Domain Sequences for d2p3rf1:

Sequence; same for both SEQRES and ATOM records:

>d2p3rf1 c.55.1.4 (F:2-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnidgkggtripisg
iagdqqaalfgq

Timeline for d2p3rf1:

• d2p3rf1 first appeared in SCOP 1.73
  
• d2p3rf1 does not appear in SCOPe 2.01