Lineage for d2p33a1 (2p33 A:45-400)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874380Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 874381Species Human (Homo sapiens) [TaxId:9606] [56138] (16 PDB entries)
  8. 874393Domain d2p33a1: 2p33 A:45-400 [139468]
    automatically matched to d1jnk__
    complexed with j07

Details for d2p33a1

PDB Entry: 2p33 (more details), 2.4 Å

PDB Description: synthesis and sar of aminopyrimidines as novel c-jun n-terminal kinase (jnk) inhibitors
PDB Compounds: (A:) c-Jun N-terminal kinase 3

SCOP Domain Sequences for d2p33a1:

Sequence, based on SEQRES records: (download)

>d2p33a1 d.144.1.7 (A:45-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv
vtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcp
efmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidp
akrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d2p33a1 d.144.1.7 (A:45-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
vddalqhpyinvwyrehtieewkeliykevmn

SCOP Domain Coordinates for d2p33a1:

Click to download the PDB-style file with coordinates for d2p33a1.
(The format of our PDB-style files is described here.)

Timeline for d2p33a1: