Lineage for d2p1ha1 (2p1h A:1-94)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772704Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 772705Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 772745Family a.77.1.3: Caspase recruitment domain, CARD [81313] (5 proteins)
  6. 772746Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. 772747Species Human (Homo sapiens) [TaxId:9606] [47998] (6 PDB entries)
  8. 772750Domain d2p1ha1: 2p1h A:1-94 [139457]
    automatically matched to d1cwwa_
    complexed with zn

Details for d2p1ha1

PDB Entry: 2p1h (more details), 1.59 Å

PDB Description: rapid folding and unfolding of apaf-1 card
PDB Compounds: (A:) Apoptotic protease-activating factor 1

SCOP Domain Sequences for d2p1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p1ha1 a.77.1.3 (A:1-94) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
gsmdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlik
milkkdndsyvsfynallhegykdlaallhdgip

SCOP Domain Coordinates for d2p1ha1:

Click to download the PDB-style file with coordinates for d2p1ha1.
(The format of our PDB-style files is described here.)

Timeline for d2p1ha1: