SCOPe 2.05: Domain d2ozbd1: 2ozb D:4-128

Lineage for d2ozbd1 (2ozb D:4-128)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Spliceosomal 15.5kd protein [55321] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries)

8. Domain d2ozbd1: 2ozb D:4-128 [139446]
   Other proteins in same PDB: d2ozbb1, d2ozbe_
   automatically matched to d1e7ka_
   protein/RNA complex; complexed with ca

Details for d2ozbd1

PDB Entry: 2ozb, 2.6 Å

PDB Description: structure of a human prp31-15.5k-u4 snrna complex

PDB Compounds: (D:) U4/U6.U5 tri-snRNP 15.5 kDa protein

SCOPe Domain Sequences for d2ozbd1:

Sequence; same for both SEQRES and ATOM records:

>d2ozbd1 d.79.3.1 (D:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

Timeline for d2ozbd1:

• d2ozbd1 first appeared in SCOP 1.73
  
• d2ozbd1 appears in SCOPe 2.04
  
• d2ozbd1 appears in SCOPe 2.06
  
• d2ozbd1 appears in the current release, SCOPe 2.08