![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Spliceosomal 15.5kd protein [55321] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries) |
![]() | Domain d2ozbd1: 2ozb D:4-128 [139446] Other proteins in same PDB: d2ozbb1, d2ozbe_ automatically matched to d1e7ka_ protein/RNA complex; complexed with ca |
PDB Entry: 2ozb (more details), 2.6 Å
SCOPe Domain Sequences for d2ozbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozbd1 d.79.3.1 (D:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi erllv
Timeline for d2ozbd1: