Lineage for d2ozba1 (2ozb A:4-128)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657980Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1657981Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1658082Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 1658083Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries)
  8. 1658084Domain d2ozba1: 2ozb A:4-128 [139445]
    Other proteins in same PDB: d2ozbb1, d2ozbe_
    automatically matched to d1e7ka_
    protein/RNA complex; complexed with ca

Details for d2ozba1

PDB Entry: 2ozb (more details), 2.6 Å

PDB Description: structure of a human prp31-15.5k-u4 snrna complex
PDB Compounds: (A:) U4/U6.U5 tri-snRNP 15.5 kDa protein

SCOPe Domain Sequences for d2ozba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

SCOPe Domain Coordinates for d2ozba1:

Click to download the PDB-style file with coordinates for d2ozba1.
(The format of our PDB-style files is described here.)

Timeline for d2ozba1: