Lineage for d2oy4f1 (2oy4 F:86-242)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729468Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 729469Species Human (Homo sapiens) [TaxId:9606] [55533] (19 PDB entries)
  8. 729478Domain d2oy4f1: 2oy4 F:86-242 [139431]
    automatically matched to d1bzsa_
    complexed with ca, zn

Details for d2oy4f1

PDB Entry: 2oy4 (more details), 1.7 Å

PDB Description: Uninhibited human MMP-8
PDB Compounds: (F:) Neutrophil collagenase

SCOP Domain Sequences for d2oy4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oy4f1 d.92.1.11 (F:86-242) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOP Domain Coordinates for d2oy4f1:

Click to download the PDB-style file with coordinates for d2oy4f1.
(The format of our PDB-style files is described here.)

Timeline for d2oy4f1: