Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55533] (19 PDB entries) |
Domain d2oy4a1: 2oy4 A:86-242 [139430] automatically matched to d1bzsa_ complexed with ca, zn |
PDB Entry: 2oy4 (more details), 1.7 Å
SCOP Domain Sequences for d2oy4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oy4a1 d.92.1.11 (A:86-242) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl ahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d2oy4a1: