![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
![]() | Domain d2ow8q1: 2ow8 q:1-83 [139414] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1 protein/RNA complex protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8q1 d.27.1.1 (q:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2ow8q1: