Lineage for d2ow8j1 (2ow8 j:2-128)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853092Protein Ribosomal protein S9 [54218] (2 species)
  7. 853120Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 853154Domain d2ow8j1: 2ow8 j:2-128 [139407]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1fjgi_
    complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8j1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (j:) 30S ribosomal protein S9

SCOP Domain Sequences for d2ow8j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8j1 d.14.1.1 (j:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d2ow8j1:

Click to download the PDB-style file with coordinates for d2ow8j1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8j1: