Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries) |
Domain d2ow8i1: 2ow8 i:1-138 [139406] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1 automatically matched to d1fjgh_ complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3 |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOP Domain Sequences for d2ow8i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8i1 d.140.1.1 (i:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2ow8i1: