Lineage for d2ow8h1 (2ow8 h:2-156)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918656Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 918657Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 918658Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 918659Protein Ribosomal protein S7 [47975] (4 species)
  7. 918689Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 918731Domain d2ow8h1: 2ow8 h:2-156 [139405]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1fjgg_
    protein/RNA complex

Details for d2ow8h1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (h:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2ow8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8h1 a.75.1.1 (h:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2ow8h1:

Click to download the PDB-style file with coordinates for d2ow8h1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8h1: