Lineage for d2ow8g1 (2ow8 g:1-101)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862903Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 862904Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 862905Protein Ribosomal protein S6 [54997] (4 species)
  7. 862935Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 862981Domain d2ow8g1: 2ow8 g:1-101 [139404]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1fjgf_
    complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8g1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (g:) 30S ribosomal protein S6

SCOP Domain Sequences for d2ow8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8g1 d.58.14.1 (g:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d2ow8g1:

Click to download the PDB-style file with coordinates for d2ow8g1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8g1: